PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA007600-PA
Common NameOsI_05974
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family M-type_MADS
Protein Properties Length: 230aa    MW: 24644.8 Da    PI: 6.7382
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA007600-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.61.4e-223075146
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                      k ienk  rqv fskRr+g++KKA+ELSvLC+a+vav+ fs+ g+ 
  BGIOSGA007600-PA 30 KLIENKEARQVCFSKRREGVFKKASELSVLCGARVAVVFFSPAGRP 75
                      569***************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.8382282IPR002100Transcription factor, MADS-box
SMARTSM004323.1E-282281IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.62E-262391IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-182444IPR002100Transcription factor, MADS-box
CDDcd002651.07E-302791No hitNo description
PfamPF003191.2E-243278IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-184459IPR002100Transcription factor, MADS-box
PRINTSPR004049.9E-185980IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MAKAAAEMDV GGGEGRRRKR TRGRQRIEMK LIENKEARQV CFSKRREGVF KKASELSVLC  60
GARVAVVFFS PAGRPHCFGH PSVPAVADRF LLGRSPAVAA AAAAEEEEAD RVQAEASERV  120
HDIIVEEAMT HYTGAAAAAA NLIDYLDAGP FVSHSPGSHD TTTKLIGGNA VHAPPLSFPP  180
MIMPPPLPPQ FSHGFGYTDL AAGYGYNLDH GHGAAYETEE FHNAAACDFF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11525RRRKRTRGRQR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126100.0CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624326.11e-106PREDICTED: MADS-box transcription factor 50-like
TrEMBLA2X1961e-168A2X196_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA007600-PA1e-168(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP133092432
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.15e-21AGAMOUS-like 29